PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI04G24470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 254aa    MW: 28802.6 Da    PI: 8.9745
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI04G24470.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.18.6e-321463150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ 
  ORUFI04G24470.1 14 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 63
                     79**********************************************95 PP

2K-box1033.8e-3484178599
            K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      s+++l+  +++s++qe+++Lk ++e Lqr+qRh+lGedL++Ls+keLqqLe+qLe sl++ R++K+++++eq+++l++ke++l e nk+L++kl
  ORUFI04G24470.1  84 SNSALAGGEHQSWYQEMSRLKTKLECLQRSQRHMLGEDLGPLSIKELQQLEKQLEYSLSQARQRKTQIMMEQVDDLRRKERQLGELNKQLKNKL 177
                      334488899************************************************************************************9 PP

            K-box  99 e 99 
                      e
  ORUFI04G24470.1 178 E 178
                      7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.571666IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-41665IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-32781IPR002100Transcription factor, MADS-box
CDDcd002651.04E-43782No hitNo description
PROSITE patternPS003500862IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-33828IPR002100Transcription factor, MADS-box
PfamPF003193.1E-271562IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-332843IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-334364IPR002100Transcription factor, MADS-box
PfamPF014866.1E-3192177IPR002487Transcription factor, K-box
PROSITE profilePS5129717.61393183IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MDRSEMGRGR VELKRIENKI NRQVTFSKRR NGLLKKAYEL SVLCDAEVAL IIFSSRGKLY  60
EFGSAGINKT LEKYNSCCYN AQGSNSALAG GEHQSWYQEM SRLKTKLECL QRSQRHMLGE  120
DLGPLSIKEL QQLEKQLEYS LSQARQRKTQ IMMEQVDDLR RKERQLGELN KQLKNKLEAE  180
ADSSNCRSAI QDSWVHGTVV SGGRVLNAQP PPDIDCEPTL QIGYYQFVRP EAANPRSNGG  240
GGDQNNNFVM GWPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J1e-21774168Myocyte-specific enhancer factor 2A
3p57_I1e-21774168Myocyte-specific enhancer factor 2A
3p57_D1e-21774168Myocyte-specific enhancer factor 2A
3p57_C1e-21774168Myocyte-specific enhancer factor 2A
3p57_B1e-21774168Myocyte-specific enhancer factor 2A
3p57_A1e-21774168Myocyte-specific enhancer factor 2A
3kov_J1e-21774168Myocyte-specific enhancer factor 2A
3kov_I1e-21774168Myocyte-specific enhancer factor 2A
3kov_B1e-21774168Myocyte-specific enhancer factor 2A
3kov_A1e-21774168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1091530.0AF109153.1 Oryza sativa MADS box transcription factor MADS17 (MADS17) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634419.10.0PREDICTED: MADS-box transcription factor 17
SwissprotQ7XUN20.0MAD17_ORYSJ; MADS-box transcription factor 17
TrEMBLA0A0D3FZB80.0A0A0D3FZB8_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0H5180.0A0A0E0H518_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PD480.0A0A0E0PD48_ORYRU; Uncharacterized protein
TrEMBLA0A0D9ZPN60.0A0A0D9ZPN6_9ORYZ; Uncharacterized protein
TrEMBLQ0JAS40.0Q0JAS4_ORYSJ; MADS17
STRINGLOC_Os04g49150.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41873566
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.17e-92AGAMOUS-like 6